SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024024m|PACid:19701574 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024024m|PACid:19701574
Domain Number 1 Region: 7-48
Classification Level Classification E-value
Superfamily F-box domain 0.00000824
Family F-box domain 0.0073
Further Details:      
 
Weak hits

Sequence:  Si024024m|PACid:19701574
Domain Number - Region: 110-223
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00137
Family SGL-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si024024m|PACid:19701574
Sequence length 371
Sequence
MTASRAKRSAPWADLQPELLGLVLRRLPSLADRVRLRAVCHWWRRVARLEEPLLPPPLPW
VALHDATFVSLPAGEIHRMPPPLPRIDSFARVRRRVMTALFKLVLPSSGHLSPDSLFAVL
FSSDGDSTISVGQAATTTTSFWVPRESITDVAFFDGKLYAISRSNKLFVLDIDSSDEGQP
RIQSMKRIAGCISNESQSFPKSKSYNYTCWRYLAESGGRLLQIRRLTRVPSTVRGCERSR
RPCTVSFDVFEADLTNPCGQWRPVNTLGGQALFVGTHSKSLPASECGAQEDCIYFLSDYD
WGYYDKDPFRDCGVFNMRNGMITPMSPKIAAMQTQGNKTVCQEQVQVSWASMEKKTECQG
RPAWFFHAEAM
Download sequence
Identical sequences K3ZBV3
Si024024m|PACid:19701574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]