SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024047m|PACid:19699915 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024047m|PACid:19699915
Domain Number 1 Region: 18-81
Classification Level Classification E-value
Superfamily F-box domain 0.00000000011
Family F-box domain 0.012
Further Details:      
 
Weak hits

Sequence:  Si024047m|PACid:19699915
Domain Number - Region: 77-147,301-342,439-454,516-556,596-636
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.000353
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.046
Further Details:      
 
Domain Number - Region: 379-401
Classification Level Classification E-value
Superfamily F-box domain 0.00719
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si024047m|PACid:19699915
Sequence length 657
Sequence
MEEEAPPAPTADINQDAPVLPPEVITEIFARLPAKSVGRFRCLSRAWCAMLSTDYFVDLH
LRCANRPDHPRLLLTAVGSDYDDHLHSWRPGGAVEKLMPDDFADAITTPVTKPCRGLILI
GDAGYGGYFVCNPSTGDVLALPDSEAPKKMTWRVNKLFQPQPPPLFVDVSYGIGYCTMRK
EFKLVRFFCNSETENGLAESTNCEVFVLDRAAYWRPTTEQPPLRWVEKRSQLISDETFGS
LPPPSGFEDAASVMTELDGCLSLGYGEPDSGDLYHVFVLRDYKEARWEMLCCVNRSLWMA
PLGMYYSDGAQKIMFGTGACKVFAVDVDGTAPQVLFTPDDTIIGSCEDDHIPALGLYEES
LVPAGRTIEEIICSSPTAEAWFDILKWLPVRSVLELSLVCREKFTDGNRPPLISDLVSQP
VRVSCAFWGFICNPAIGYCEHIEFDNSNDTFFAGRIGLGYDSEIDKHLLVHITYKEDNLE
TRYYELQCKMRYVNHEQWRPLDPPPRPVAAMPPTFVNGNIYWMVEPNLGPVSATCEIVAF
DIQTQEFEVLQGPPCSHDSGHMTILQLQGALYRGVWLMKYHIELEKFLPDYLLENTTPLV
VDPKDGRILLNAGWSLGYYDPKTAEIETIYTQDVPEHGWKFCPIICHESLVWPFGPS
Download sequence
Identical sequences K3ZBX4
Si024047m|PACid:19699915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]