SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024058m|PACid:19702407 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024058m|PACid:19702407
Domain Number 1 Region: 23-123
Classification Level Classification E-value
Superfamily F-box domain 0.000000000051
Family F-box domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si024058m|PACid:19702407
Sequence length 375
Sequence
MSDVVSHRTQTSPTTTAAARAATTFGDLSDDLHADIFLRSPPQPHWLLPISQVCRRWHRL
VTSWDFLRSFRARHGGTPPLIGVFHDNCQEGLHRFIPTAAMPATVGAFHCRTSWRILDCR
HGRVLFLDAHAAARDGWRRLVLILWDPMAGSCQGIPMPPAWTVYDNGGSITGAMVCPGGD
CRYSPFKVVLMIRRAARLLVSVYSSVASEWSEVISYQGLPRWADPLMDPCVVTGSTVYQP
LLGHQTLSFDLETKSFAVIPHPPATKWLHQHVRILRLDGGVLGAVAVDNVEFSMALWVRE
DAGWVQQWTVQVNMLGKGELRHVKLLGACENGNFILLWTRLGIFMLHLQSMELKEMPIDH
TMTVGTLYPYQSFAR
Download sequence
Identical sequences K3ZBY5
Si024058m|PACid:19702407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]