SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024081m|PACid:19700921 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si024081m|PACid:19700921
Domain Number - Region: 23-57
Classification Level Classification E-value
Superfamily F-box domain 0.000113
Family F-box domain 0.013
Further Details:      
 
Domain Number - Region: 268-341
Classification Level Classification E-value
Superfamily RNI-like 0.0604
Family Cyclin A/CDK2-associated p19, Skp2 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si024081m|PACid:19700921
Sequence length 461
Sequence
MLDETPAKKPRLCSAGDTSCGDAAAAASPVDRLSALPDAMLHHVMSFLRAWEVARTCGFA
KFVYRFLLEREESAPVDTLQLLSSPACGDPYWRLPSPSCDGDRVDYSSDDVDMWIHAAIK
RKARVIQLARHPKEEDCPQFERVSIASRHLKHLIFIQENLTIAAPNLLSLCCVKLYFRVP
LFQNMGSIATATIVLDDSLHVGYEHEPKLTHDDASTCEYNEVLSDNEDEQSDDHGQGQDR
CKHCKCNGDPYWIKRGYGRRNGFGDDKILGGHNVLHSLSNATSLKLLADAGEVILNRELK
ARPVFSNLKTLSLGEWCMAADFDPVVFFLQHSPNLERLFLELKLVKEEMEDNTRLVGRSF
VCAHLKLVKIKCSEYETRVHLLAELFKANDVPVEKIYHEALKPDGGSHAGTAVLDVYMSC
HVRCDDLVYLCGQETAALFLKKNGAKLTDDMPADLFGMAVL
Download sequence
Identical sequences K3ZC08
Si024081m|PACid:19700921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]