SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024083m|PACid:19702425 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si024083m|PACid:19702425
Domain Number - Region: 17-58
Classification Level Classification E-value
Superfamily F-box domain 0.0517
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si024083m|PACid:19702425
Sequence length 133
Sequence
MGKPRASPAPAFLADNEDLLLEILLRLLPLLSLLPRASLRRLLSDPQFLRRFRAYHRKRP
MLGFFSVDFHNEDGPIPVFAPTLAAPDHIPPMRFFFPNHPCEVLFFFGCHHGLALLFNRR
KLEAVVWDPITHL
Download sequence
Identical sequences K3ZC10
Si024083m|PACid:19702425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]