SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024136m|PACid:19701686 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024136m|PACid:19701686
Domain Number 1 Region: 15-71
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000131
Family F-box domain 0.0083
Further Details:      
 
Weak hits

Sequence:  Si024136m|PACid:19701686
Domain Number - Region: 239-377
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000327
Family All0351-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si024136m|PACid:19701686
Sequence length 390
Sequence
MAGGSGSKKRARRTRKPDPTALLTDDLLVEILARVPYRSLCRCRCVSKRWRALISHPDHR
ARLPQTLAGIFYHGPVAVGGGGSPESTSTSNCFASVPGTAPPLIHTSFSFLPDREREELV
LVDSCNGLILCRCYRFPDEGEFDYLVLNPATEKWVAVPITRRWSSKVQTVHLGFDPAVSS
HFHVFEFQVDIDDDDYDAGDGHVLGVKIYLSATGVWSHRQSGWSMEISFELDLKSVFLDG
MLYVIARESVVGSVDVEGKTWRIINFPRSKDSRFYDTGGGFIDLSQGRLHLANDDDMVGD
KLAIWVLEDKDNEQWTLKHTVRNKHLVRRKHVHFGFHEFIVVAIHPDRNMVFFVFGLEKT
LISYDMDSGKVSIIRNLGRTCNEHFLPYVP
Download sequence
Identical sequences K3ZC62
Si024136m|PACid:19701686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]