SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024231m|PACid:19701875 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si024231m|PACid:19701875
Domain Number - Region: 6-41
Classification Level Classification E-value
Superfamily F-box domain 0.000157
Family F-box domain 0.01
Further Details:      
 
Domain Number - Region: 153-355
Classification Level Classification E-value
Superfamily YWTD domain 0.000249
Family YWTD domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si024231m|PACid:19701875
Sequence length 393
Sequence
MPTVQWCGLPTEIWGEIISRIDVLVVMSFSSTCKSLESVCKTLGATILKSGSAILVTSQL
DQDGWGVEDDLKTGKFGLHDVSNTLSFCCVNEGLQRRIWLGGKGDWLVSTNPSLDVPLPS
FGNNLHGIELQSYRELSVIFPPFARDIRRVVLSRTPSHADGYEAIALFSDGLLTYIAEGE
NVWRVLKNPTDHDDNAYNYYLEVSLDVIVYHGWVIAIEEDGDIFAWHMSGSDFDTSAVEH
VFYLAISPSDQLILACLYGHDFGHNSKPSRMVWNEHDRFEQLDSISMFEFDDANVTWRRI
SSIGKDQSLFLGLNYPFFVTSTNLKGNSIYVADVGNYDVGICSLGKEGQVSITKQDFPVD
EKAHLLKGWTIRTLMWFRPTTHAKAKNWFIFIV
Download sequence
Identical sequences K3ZCF6
Si024231m|PACid:19701875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]