SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024261m|PACid:19700226 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024261m|PACid:19700226
Domain Number 1 Region: 29-104
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000157
Family F-box domain 0.0037
Further Details:      
 
Weak hits

Sequence:  Si024261m|PACid:19700226
Domain Number - Region: 116-266
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0157
Family Galactose oxidase, central domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si024261m|PACid:19700226
Sequence length 414
Sequence
MLLKFQDLARCFIGSERAAASAIKTCAAPSLPAPATVSLPDNEDLLREILLRLPPLPSSL
PRASLVCKRWRRLVSDAGFLRRFREHHRTPPLLGYFFNDHRGPVFTPTLAPPNSIPPARF
SLPQQQPAGERLFFLGCRHGLALLINRRRLEAIVWDPVTNRQATVAYPSEFTTDNGAHCC
RGAVLSGGGGGGGDGDALVPGGDDGHLMRPFKVILIRTEINHDHASVFIMCVYESGTGKW
GNTISTTILSPFSNLPNVLIGNAVLCGFFQWSNGFLELDLDRQRLGVIETPVSLHSVDSS
ISRVVRTQDRGLGLAILSRFSIQMWGRKADSGGVVGWVLQKTIQVDKLLSLPPSMDSLPA
RILGYDEDSNAIHLSTSTGAFAIQLESMQFRELFNVYRIGSYYSCHPYASFYTA
Download sequence
Identical sequences K3ZCI6
Si024261m|PACid:19700226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]