SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024268m|PACid:19700896 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024268m|PACid:19700896
Domain Number 1 Region: 3-39
Classification Level Classification E-value
Superfamily F-box domain 0.0000000392
Family F-box domain 0.0059
Further Details:      
 
Weak hits

Sequence:  Si024268m|PACid:19700896
Domain Number - Region: 29-92
Classification Level Classification E-value
Superfamily Citrate synthase 0.00628
Family Citrate synthase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si024268m|PACid:19700896
Sequence length 172
Sequence
MEDRLSSLPDDLLHSILCGLPLKHAARTSALSRRWVPQWIRALATSPVLDFTDWDFARGQ
PPARPAATVDRCLRLHAEHGTPLHVSHVALVSVSPSGPGDGAFGRDVVWWIAAAVAWGAR
EVEVDLTTSQEEDAVPHADHGSAAFLELPADLFRARNYQMQGKDEIREQSKT
Download sequence
Identical sequences K3ZCJ3
Si024268m|PACid:19700896 XP_014660344.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]