SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024380m|PACid:19698845 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024380m|PACid:19698845
Domain Number 1 Region: 14-70
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000157
Family F-box domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si024380m|PACid:19698845
Sequence length 99
Sequence
MDADDAPHVANGNYGVLPADVLYNIFLCLPANPLCHLRLVCHSWWSLTPDPLFARAHSSR
HPHVAALHCNLQALHVVDLHDKIVVKRLHLGQPGFFLGT
Download sequence
Identical sequences K3ZCV0
Si024380m|PACid:19698845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]