SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024390m|PACid:19701106 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024390m|PACid:19701106
Domain Number 1 Region: 32-89
Classification Level Classification E-value
Superfamily F-box domain 0.0000000262
Family F-box domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si024390m|PACid:19701106
Sequence length 135
Sequence
METESRRRRRLSTGETSRDGTRAGHYSLRTSPPTGIHDLADDLLELVLARIRSPACLLNA
TATCKLWRRVIGGASFVRRFRSLHAPCYSATTTLAARTIFVPSLAPPGAPAAVTTRLDIC
DGVLRDFLLGKLARR
Download sequence
Identical sequences K3ZCW0
Si024390m|PACid:19701106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]