SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024404m|PACid:19701457 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024404m|PACid:19701457
Domain Number 1 Region: 8-72
Classification Level Classification E-value
Superfamily F-box domain 0.0000000929
Family F-box domain 0.01
Further Details:      
 
Weak hits

Sequence:  Si024404m|PACid:19701457
Domain Number - Region: 106-363
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000222
Family SGL-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si024404m|PACid:19701457
Sequence length 381
Sequence
MVRPEKRRRRMMAATIPDDLLIQKSVGRCRCVCRSWRAGIASAAFVRRHLELSRASPPSV
LAIPRKTDRFDERATSSEISFHRLPLPPPGQAQGILHWELLLEKAWPEGITCLILPAHCD
GLVAIATVTDRVFVCNPATREFLALPLGSHNAELDHTEDLVPQALGFDRWRNRYVVARYF
YRTYGEPFVDEVNGEYHAAPDHDVGHEVFTLGGDSWELTQDPPHPVGVHQPICTRRAFYW
HADEPQPRLMRFSLQHRAFDVVRRPPTGWNPGVDDMAGLDDGKRLCYVHAAAEASFQVWM
ADDDGGPELQWSLQWRINLRDPVPYLNYSLMPVIADGDTLVAVAGGTMWRCDMQDEGVEE
VVVELHNVRYGRLDGSVYYVV
Download sequence
Identical sequences K3ZCX4
Si024404m|PACid:19701457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]