SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024432m|PACid:19697897 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024432m|PACid:19697897
Domain Number 1 Region: 19-60
Classification Level Classification E-value
Superfamily F-box domain 0.0000017
Family F-box domain 0.011
Further Details:      
 
Weak hits

Sequence:  Si024432m|PACid:19697897
Domain Number - Region: 140-285,323-351
Classification Level Classification E-value
Superfamily RNI-like 0.00175
Family Rna1p (RanGAP1), N-terminal domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si024432m|PACid:19697897
Sequence length 512
Sequence
MMQPPSLPSGCDGNSDGDLDRISKLPDEIKGLILFLLPLKEAGRTTTLSKGWKGVFASSP
ISLDDEHVTRRRVGRPRHEAILHPERVDVISQILEKHKGPIPRVRLAKTHFHGHGDHGYG
IDTDAFVGRGVEELIVHSTDPIQFFPAPPLRSIVVVRCDWFPPEQPLPAVFGSIKELSLC
AVNFSAAGVHALLEQCFKLESFLLSSYYKDEKDRLIDVEGTEDYGCTLQIRSRSLRSLCV
EVLGLKGVVIVDAPNLERLLGEVSIDTSYCKVTLVHAPKLEILGFLTMDLPRTRRSIAGN
IMMLGMILEPSCPIRSVKILGLCLNLCNPAQVELMLQVLNYFPCVETLNIKIYTDPSIRH
TLYSEAPYANLLELAGRVACLRDSVKTIVLSDLWVHTHTFGLQFANMLLESAKKLQLMKI
FHVPVDKRKQARSTRHKLGLKSNPSIKAQVVFPRDYISYRQVSDVLMDTSSLALPDPMFC
QRKFQSSNFIRILWNSYLNPVNKDYYSDALVG
Download sequence
Identical sequences K3ZD01
Si024432m|PACid:19697897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]