SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024442m|PACid:19700842 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024442m|PACid:19700842
Domain Number 1 Region: 15-74
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000288
Family F-box domain 0.0098
Further Details:      
 
Weak hits

Sequence:  Si024442m|PACid:19700842
Domain Number - Region: 118-152,325-377
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000255
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 
Domain Number - Region: 218-374
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000334
Family DPP6 N-terminal domain-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si024442m|PACid:19700842
Sequence length 415
Sequence
MVRPDKRRRRVTAAATIPDDLLISEVLVRLPAKSLGRCRCVCRSWRSSIAGATFVRRHLE
LSHAAPRSVLAIPRRINRFDDHATSSEISFHRLPLPPPGHAPGILHSELLLEKVWPEGIT
CLILPAHCDGLVAIATVTDRVFVCNPATTEFLALPVGSHNAELDHCDYLVPRVALGFDQW
RNRYVVARYFYRIYGEPFVDEVTGEYHGAPDHDVGHEVFTLGGDSWELTQDPPHPVGVHQ
PTCTRRAFYWHADEPQPRLMRFSLQHRAFDVVRRPPTGWNPDVDDMAGLDDGKRLCYVHA
EAEASFQVWMADDDEGPELQWSLRWRIDLRDPVPSLNYSLMPVIADGDTLVAVAGGTMWR
YDVQNEGEEEVVVELHNVRYGRQDGSVYYYKGPPSFEHYIVPYVESLVSPRACNV
Download sequence
Identical sequences K3ZD11
XP_004964139.1.39314 Si024442m|PACid:19700842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]