SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024446m|PACid:19699617 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si024446m|PACid:19699617
Domain Number - Region: 9-49
Classification Level Classification E-value
Superfamily F-box domain 0.000366
Family F-box domain 0.0076
Further Details:      
 
Domain Number - Region: 191-356
Classification Level Classification E-value
Superfamily YWTD domain 0.000706
Family YWTD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si024446m|PACid:19699617
Sequence length 408
Sequence
MPSSIVLAMPIVQWCELPTKICGGIISRIDVLDVMSFSSTCKSLQLVCKTLRATVLKSGN
GWGIEDDLKTGKFGLHDVSNALSFCCVNEVLQHRIWLGGKGDWLVTTNTSLDLELLNTIT
RTKVPLPSFGNNLSGIELPSYRELTVIFSPFSHDVRRVVLSQMPSHADGYEAITLFSNGL
LTHTAQEVFLDVIVNHGLVIAVEEDGDIFASDMSGMDLTPVQLPMPKTTPSEEELERVLY
LAISPSNQLILACLSGHDFGHNNKASRMVWNEHDRFEQLADSISMFEFDDADVTWRRISS
IRKDRSLFLGLNYPFFVTSTDLKGNSIYVAYVRNFAVGICSLDTEGQVSITNQGFLVDEK
ACLLQGWTIRTPMWFGPSTHARKQLVYIYSIDFLVTLLVLHSIVMLDD
Download sequence
Identical sequences K3ZD15
Si024446m|PACid:19699617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]