SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024475m|PACid:19697833 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024475m|PACid:19697833
Domain Number 1 Region: 32-81
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000824
Family F-box domain 0.01
Further Details:      
 
Weak hits

Sequence:  Si024475m|PACid:19697833
Domain Number - Region: 113-287
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0294
Family DPP6 N-terminal domain-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si024475m|PACid:19697833
Sequence length 423
Sequence
FGLHRGAHLRAPPSKKTREETPPPACQQLQQLLPDEVIEDIFIRLPARSAARCRCLSRSW
AAVLSSRALSRHLAAAANNRLSFPAALSAWSREHPDAEPLTRFSCRGLGLLRSVSAGVVY
VCNPSTGQVASLPDGTATATGDWIDHDYACFGLGYDARAGRHKAVHVYYHGGGGGGGAGC
EVYDVGGAKPPCFVVAGVLDTAGVFAQGHVYWLAAAAKAPAYDEWPPRADSVLSFSPGDE
TFASTALPPRACCKVWRLRDDPTARSVPAPPVLADVDVPPVYIDDDGGGGRIYWMCRSPR
AILAFGILAEAFDIVPAPPPGWSGGGVDDGSTEGRSASCSRARARRRRRIEPVIPMAIEP
KDGGRILLDTGRSLGYYDPVRRTVETVYSLRSKLKRSDQRFFAAALWEESLVRPYDRGER
FQC
Download sequence
Identical sequences K3ZD42
Si024475m|PACid:19697833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]