SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024507m|PACid:19700987 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024507m|PACid:19700987
Domain Number 1 Region: 6-48
Classification Level Classification E-value
Superfamily F-box domain 0.00000000746
Family F-box domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si024507m|PACid:19700987
Sequence length 313
Sequence
AAAAAATSDGWDGIPADVFVDILRRIPPCPRWRLRLVCRHWRDVIDERAPEPRANVTKVL
AFIRESGCCRAFVFDDLTTGRSRRWTWRTAAFGYHPATGQYKIVHVLCSEQDSNLDAVLV
FTLGDGSWQWREVPAPVGIHGVTYWATKDGKGIMSFDLKDEQVAPVEVPPLPAPGPMEWW
RPSCQLTDVGGRLGLRSKTKVWVLEDGSEVEWTWVKRYTVLAHRAYRRQQIPLPHVAHGE
HVLTTGEPWERSISLRQTLEAHRPRQERKMRPCGMVRVGAPRPETTVGVYALEEPSHSHI
RPRRDQGASARVR
Download sequence
Identical sequences K3ZD73
Si024507m|PACid:19700987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]