SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024523m|PACid:19700854 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024523m|PACid:19700854
Domain Number 1 Region: 174-249
Classification Level Classification E-value
Superfamily F-box domain 0.00000000445
Family F-box domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si024523m|PACid:19700854
Sequence length 573
Sequence
CRRSAAVAPSPGLISDGRKAKKPRAAVISFSVTSETFSWVRSPPFSVSGSHLVVLDGHLC
MVRDLLRRWPSMLEIWKLEDYSSGDFVGSKAVKVIGSFGDSKPSEKIIIATSRHKVSTYD
TMSRTLETIHSTMETETCHRIEPCDIRFSLFRETLVPVYRTKEEIALSSPMAKVTKEILL
RLPAKSALNFKFVCQKWHSLIRSDSFCHAYFLHKNVDRRPKIMLVGKLTGEKGFSSIPLD
KWLQQASDDQGALLDTKKYRNQGLMLHQDLERHVNPVEPDHHPFAVGNKNVGLGFNPLTQ
EHVIVEMFYHIKDYQSRRYYLSCSVTDCDSRNVQQLPPPPLPVNDMPSAYLEGMLYWMSE
PRLGLNHERAIVSFNIATRMFDVIPCPSRIARSWDSQSPRRAFVAELEGVLCAVLANPVR
DELCMWTWEHGQWDRSYTIYLKSCLDYSLGTNIVVPWAIDPTDGRILLNTGRRLGFYDPL
KREVENYIALDQVPLLKWKEQTLCPGAGDQMPLDQPSSSSTSPGKNLSHSIDRSEELNGM
SCNLSPLVPMLYEESLAYYRTPGRARILQALPI
Download sequence
Identical sequences K3ZD89
Si024523m|PACid:19700854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]