SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024569m|PACid:19701480 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024569m|PACid:19701480
Domain Number 1 Region: 14-103
Classification Level Classification E-value
Superfamily F-box domain 0.0000000837
Family F-box domain 0.0098
Further Details:      
 
Weak hits

Sequence:  Si024569m|PACid:19701480
Domain Number - Region: 119-239
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0144
Family Galactose oxidase, central domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si024569m|PACid:19701480
Sequence length 409
Sequence
MEPRPRQRRRKAGTEKPRTIHDVPDDILRQILLGLDSPLWLLRAACACRQFRRAVASADG
GRAFLRLAGSLHPPVVVGHYHNRSVRPIAFVPSPWTLAPPIDCGRFALDFLPRRIITTTD
WVVADCHGGLFVLWDSQNSPPNLIVCDPLTRRGQGIPHPPGKRAGFVVALLDGDGDGNMS
ISNFRVLYYCFHGDGAPPQVCVFSAADGGDGWRFLRRPPSAGSNYLGHVAGRVDGSIYLD
SVAGKVRVLDNARLEASEVHLPIGIDKSKAPRRSSFTVVHGAGANPTSPPSTWIIHVHGE
ELEFFRRVRGCSGGEWVLEHNIPKLSEVARGLLAGCPEERLEWTEEYVIAVGTGTAVLSA
GDRDERKLLFSIDMDTKKLQVAPKEAYRRTNWTFTYTLPWPQLLKACPS
Download sequence
Identical sequences K3ZDD3
Si024569m|PACid:19701480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]