SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024677m|PACid:19701150 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si024677m|PACid:19701150
Domain Number - Region: 48-135
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 0.0114
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.021
Further Details:      
 
Domain Number - Region: 1-47
Classification Level Classification E-value
Superfamily F-box domain 0.085
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si024677m|PACid:19701150
Sequence length 234
Sequence
LPMEVLIIIADDVVATSFKPMEDLGNLRVVCRVMERACGDPSVGQRVAMLQIYMEGLEWL
NPDRYYNLLALLVGMANPHAYTLKGIAYFFAGTDPSLNELSRTAAGGHNVGAYLYALMLY
RKNAGATDDDIAKMYIRRLECEDDSVAIGSTGLKKLCNDGCRVCHEEAAYLVNSVTWRMH
GEPFPPAPVRGDFPCARGDCNKVKGWEQATLFCNKDCSIFHKIVEFEKRMGIDQ
Download sequence
Identical sequences K3ZDN8
Si024677m|PACid:19701150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]