SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024690m|PACid:19700165 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024690m|PACid:19700165
Domain Number 1 Region: 4-72
Classification Level Classification E-value
Superfamily F-box domain 0.00000327
Family F-box domain 0.0083
Further Details:      
 
Weak hits

Sequence:  Si024690m|PACid:19700165
Domain Number - Region: 117-227
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000523
Family Galactose oxidase, central domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si024690m|PACid:19700165
Sequence length 379
Sequence
PRSIHDVPDDLLRQILLRLDSPLWLLRAASACRQFRCAVASADSGRAFLRLASSLHPPVV
IRHYHNRWHHNCSSSVRPIAFVPSPSSPLAPPIDVTDWEVADCHGGLVVLCDRQNSPPNL
SVCDPLTRRYQGIPHPPGKRAGFVVALLDGDGKISISNFRVLYYCFHGVCVFSAADGGDG
WRFLRPPSAGSNYMGHVAGRVDGSIYLDSLTGNVRVLDNVSLELSEVCLPFGIDKSKAPW
RSAFTVVHGAGANPTWPPSTWIIHVHGEELEFFRRVRGGIGGEWVLEHSIPKLSEVARGL
QAGCPEKRLERTVVHVIAVGTGIAVLSARNHCRWRWLFSVNMDTKELQVVRQQKAYGGTE
ERTFTYTLPWPQFLRACPS
Download sequence
Identical sequences K3ZDQ1
Si024690m|PACid:19700165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]