SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024694m|PACid:19697840 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024694m|PACid:19697840
Domain Number 1 Region: 86-130
Classification Level Classification E-value
Superfamily F-box domain 0.00000183
Family F-box domain 0.0069
Further Details:      
 
Weak hits

Sequence:  Si024694m|PACid:19697840
Domain Number - Region: 178-295
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00133
Family YVTN repeat 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si024694m|PACid:19697840
Sequence length 492
Sequence
MEGQWEKIREEEDSKGSVVIFHGRSARGGGSPRHQNGSHARGLVLFHFHRIKHLGQAVSK
PDPIANSEQANRVVLVQRYSRRRPVRMAKRSAPWADLQPELLGLVLRRLPSLADRVRLRA
VCHWWRRVARLEEPLLPPPLPWVALHDATFVSLPAGEIHRMPPPVVADCDHHCHGSVGNW
LFLQHKIDGICSLVNPFSKDVVQLPRIDSFARVRSRVMTALFKLVLPSSGHLSPDSLFAV
LFSSDGDSTISVGQAATTTTSFWVPRESITDVAFFDGKLYAISRSNKLFVLDIDSSDEGQ
PRIQSMKRIAGCISNESQSFPKSKSYNYTCWRYLAESGGRLLQIRRLTRVPSTVRGCERS
RRPCTVSFDVFEADLTNPCGQWRPVNTLGGQALFVGTHSKSLPASECGAQEDCIYFLSDY
DWGYYDKDPFRDCGVFNMRNGMITPMSPKIAAMQTQGNKTVCQEPVLVSWASMEKKTECQ
GRPAWFFHAEAM
Download sequence
Identical sequences K3ZDQ5
Si024694m|PACid:19697840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]