SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024791m|PACid:19701741 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024791m|PACid:19701741
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000123
Family F-box domain 0.0057
Further Details:      
 
Weak hits

Sequence:  Si024791m|PACid:19701741
Domain Number - Region: 197-296
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0248
Family Galactose oxidase, central domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si024791m|PACid:19701741
Sequence length 317
Sequence
MPTDMLREVLLRLPADELCRPRLVCRSWGCLTSDPLFAKEHSSHHDRYVIALHVGHREIH
VLDLYGTIVMGMENSQLDLAAVSSASRPAHVFHLRTGAGDVTSGHGAWMMCPPKYTLGYV
PSTQEYKMLCFVHSYGENFGGFVQPCHVMTLGERSNGSMGFLANGNCCGGMAYFLVSQEH
AAANIEMDSIALFDLVTEEWRPAKNTQWTANKPPHYGQNLLHSEDTNRFHLSRLSGCLVV
VHQNGHDSRTDIWFLDDIEMSLWTRRYTALAIVVWQFAARILRAYNPRTSTWTDMAMLKD
YFDVGMHHGRLLCSDIV
Download sequence
Identical sequences K3ZDZ9
Si024791m|PACid:19701741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]