SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024858m|PACid:19701432 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024858m|PACid:19701432
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily F-box domain 0.0000111
Family F-box domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si024858m|PACid:19701432
Sequence length 199
Sequence
MASRQCRSLEDLPMELVTEIAGHVAATSFQPMDDLGRLRATCRVMHHACGNPSVGRHVAL
LKTYYALLPLLVRVGNPEACTLTGIVDFFAAPQPSLHELPRATASRHNVGAYLYALMMYK
NNSGTTDDNITKMYIRCVECEDGSAASDPKKLRNNGCQVCHEEATYLVTRVTWHGHGDLL
PPAPVHGDFPCAGGDCGKV
Download sequence
Identical sequences K3ZE65
Si024858m|PACid:19701432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]