SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024899m|PACid:19700209 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024899m|PACid:19700209
Domain Number 1 Region: 6-58
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000406
Family F-box domain 0.0062
Further Details:      
 
Domain Number 2 Region: 109-158,216-336
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00000536
Family Galactose oxidase, central domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si024899m|PACid:19700209
Sequence length 344
Sequence
MEMSGGGDIHALCDDALAEILVRLPSESVLRCRAVCKSWRRIATGRSFLAAHAARSPREM
ITLTQSWTLSAVPLSPGLDAADDGARRRYLCDLSRYHGDGKWAGWSTLVASLDGLLVLQQ
RPGLYVVCNPTTRQWTNLPVLAPQPCAAAFQCGFYHHRPSGEYRLLCHAEEHREPGSSDW
KDYYYTLSAGSTLPRRLARAPADRPYKTDFYELPVAHRGTLYWLCLHPERRRTGKMLAFH
TDSETFRLVSRPPTGYAPPVSALLELDGALCAVANRNWMLLDVWVLQDYEAGRWTLRHRV
AAPPPKCSDGRGLLATWAISVDGSTILVGDGISGVIGLCDLEEK
Download sequence
Identical sequences K3ZEA6
Si024899m|PACid:19700209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]