SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si024952m|PACid:19702394 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024952m|PACid:19702394
Domain Number 1 Region: 11-76
Classification Level Classification E-value
Superfamily F-box domain 0.0000161
Family F-box domain 0.014
Further Details:      
 
Weak hits

Sequence:  Si024952m|PACid:19702394
Domain Number - Region: 184-261
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0463
Family Quinoprotein alcohol dehydrogenase-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si024952m|PACid:19702394
Sequence length 409
Sequence
PRPRQWRRKAGTEEAEEPRSIHDVPDDLLRQILLRLDSPLWLLRAACAYRQFRRAVASAD
SGRSFLRLASSLHPPVVVGHYHNCRVRPIAFVPSLSPPAPPIDGGRFALDFLPRSITTTT
DWEVADCHGGLVVLCNSQNSPSNLIVCDPLTRRYQGIPHPLEKLAGFVVALLDGDGDGNI
SISNFRVLYHCFHGDGAPRQVCVFSAADGGDGWRFLRRPSAGSYYIGHVAGRVDGSIYLG
SVTGNVRVLDNASMELSEVYLPIGIDKSKAPRISTFTVVHGAGANPTSPPSTWIIHVHGE
ELEFYRRVRGGSGSGGEWVLEHNIPKLSEVARGLLAGCPEERLEVYVIAVGTGTAVLSAG
DRDERKLLFSIDMDTKKLAPKESLSPDEGDSHQFTYTLPWPQLLQACPS
Download sequence
Identical sequences K3ZEF7
Si024952m|PACid:19702394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]