SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si025160m|PACid:19698318 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si025160m|PACid:19698318
Domain Number 1 Region: 116-185,238-256
Classification Level Classification E-value
Superfamily RNI-like 0.000000883
Family Cyclin A/CDK2-associated p19, Skp2 0.083
Further Details:      
 
Domain Number 2 Region: 3-32
Classification Level Classification E-value
Superfamily F-box domain 0.00000563
Family F-box domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si025160m|PACid:19698318
Sequence length 351
Sequence
MASGADRISALPDELLHHVMSFLPMHEVVYVAARPYVDNLLLLQHPGTRLDSFNLNECDF
SFKPFLPTYDVDVNTGFQIALLCQARVISLHTSLGIYVENWDLPLELPNVTLKRSTLDFS
GCPTLVNLKMKECDINGNVPSPFLKHLSITSCYFVTRSFRARIYMPGLISLVLSECTHRT
PLLENMPLLVLVIVRVKDCENKCSKSTYGDCGDHTCLSQVTELELSVDSTVFIVNRDLKL
CPTFCKLKTLFLSAWCPGVAADRNVLTCFLQHSPIMEKLVLQLPKVPKDRVGTESSYKRS
EHSFICSHLKIVDLKCEEVDGRVQETLEILSTYGIPLEHVNIQQTDMVSGP
Download sequence
Identical sequences K3ZF11
Si025160m|PACid:19698318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]