SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si025170m|PACid:19699226 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si025170m|PACid:19699226
Domain Number 1 Region: 192-433,486-563
Classification Level Classification E-value
Superfamily RNI-like 4.12e-22
Family Cyclin A/CDK2-associated p19, Skp2 0.066
Further Details:      
 
Weak hits

Sequence:  Si025170m|PACid:19699226
Domain Number - Region: 145-180
Classification Level Classification E-value
Superfamily F-box domain 0.000288
Family F-box domain 0.0064
Further Details:      
 
Domain Number - Region: 52-57
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si025170m|PACid:19699226
Sequence length 609
Sequence
MASDASAPVPVPAAAAAVPKRRGSYNCGRCGLPKKGHVCSVPGAGGKAGEAPPPPPPQQQ
QNKPRRALQFDDPAAEGEAEAVVVVLDAAPVAMAAAPLLPPPPPAAGRKRPRVEAAAAVD
VEGEGEEAADSDSGWVELGAGRRAPGEVVLEVLRRMAPRGVAAAAGVSRGWRECARRVWR
GAEEVRLRAASVRPVGALMARCPSLARLVLRMDSDVDATMIACVAFSCPNLQTLDISMAN
SAVNRISGDELSRFVSEKRSLSVLKLDGCSSLGFLNISSSSLSTLWLSGLCSLTKAVMNC
PNLNELSLDFPKQNNDSTDLVALMDSLGRTCPNLRNMHISSIRLCNEAVFALESANLRGL
CMLSLVLGSKITDAAVASIVRSYASLELLDLSGSSITDNGLGMICNAFPNTLTRLLMALC
PNITSSGVQVAAAQLPLLRLMDCGRSICAKPQPEDGRSYFGDLTGGIKFCSKLPTQKKQQ
PSYQKLIIKHSSLKKLSLWGCSAIEALYVNCPELVDLNLNSCTNLHPERLLIQCPKLKDV
HVNGCRDMLIGAIRNQVLNEFAAAEPRLPCKRLADGSKRVHVPHFMIEQLEEQEKWGRPR
KSQCTVHLT
Download sequence
Identical sequences K3ZF21
Si025170m|PACid:19699226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]