SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si025189m|PACid:19698716 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si025189m|PACid:19698716
Domain Number 1 Region: 15-63
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000209
Family F-box domain 0.0057
Further Details:      
 
Weak hits

Sequence:  Si025189m|PACid:19698716
Domain Number - Region: 223-248,311-355
Classification Level Classification E-value
Superfamily YWTD domain 0.00126
Family YWTD domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si025189m|PACid:19698716
Sequence length 369
Sequence
MDADDAPPVADGNYGVLPADMLYYILLCLPANHLCRLRLVCLSWRSLTSDPLFARAHSSR
HPHVAALHCYLQALDVMDLHDKIVVRRIYLRQPSFCLVAQHNLICVGYTHAHYTAWRRGA
CVLSLQQGTGSTIADLSMEHDMSGRCRMPPTFKLGHVPSTGEYKVIHLYMPMAPDNSMAM
VDRCHVMTLGSGDGRWREMRKPPDSCRVAVVSGVAYFLADQCCSDMEPDSIASFDLATEE
WRSRILQGPVQPSTKDEVRMLVELGDCLVMVHHNLKDLITDLWFIEDMNKSLWTKRCSIR
WGATLLGVKRIERVRPLMVSDDGRIVFWIPAGAGVIGAYDPRTSTWVDLAKMGHYLTVAT
HQGMSLLLS
Download sequence
Identical sequences K3ZF40
Si025189m|PACid:19698716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]