SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si025215m|PACid:19700341 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si025215m|PACid:19700341
Domain Number 1 Region: 12-65
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000602
Family F-box domain 0.0051
Further Details:      
 
Domain Number 2 Region: 414-455
Classification Level Classification E-value
Superfamily F-box domain 0.000000314
Family F-box domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si025215m|PACid:19700341
Sequence length 859
Sequence
MTTGNKRVGTSGGAQVLPEEMMTEVFLRLPVKSILQCRAVCRSWADVLSSEEFCRLHMAR
AEAASATPKLFFTSPTSGFDATSVYLGSSSGPDDGLLFTLNNVRGDFMDMTSSPCHGLTL
LYDAVAPAYYVFNAATRTVTRLPPCQDSAYATAGLTFDARTKEYKVVRLFNGKYLEKQHI
KCEIYTLGGKQGDCWRPAVGGVPFRFCLAADVAISHATLDKLQPVFADGFLNWLIHPDFL
VIRPRAAILSFSITDESFRWVHSPPFVVSGVHLVELTGHLCMVRDLRNVSPDCSMLEIWK
LNDYSTGGWSLKHRIDLLQHAARDLTDPQIIRVIGSVNAYGSTKKVVIATSKRKVIAYDP
VLGTLETILAIRETYSSYQTEQSALRLSLFKESLVPVHQTNEEMALSTPLAEATREILLR
LPGDYTVQAKLVCKQWLRLIENESFMHYYYSHNNMDRRPKIMLVGKGTGGSGFSFAPLNE
LKQHIPNHDTWLDMKVVCSKPCHGMNLISTEMKDYLYNPCTGYRFVYLSREQFTHMPCNN
PGYGYMPQDHAFAVGNKNVGLGFNLLMQEHVIVRFSYQRKDFKTRQYLLTSTVITCGIGC
TQCHLYPPLPVNDMPPTYIKGLLYWMSEPRLGQTYERAIVSFDIAANSFGVISCPSCIAT
WNNRCSSLAFVVELEGSLCAVLANPVAEELDIWKLENGEWSIAYKVNLKGWSGYSLRANV
VMPLAVDPKDGRILLNTGKKLGIYDPRRHSIESLYDLDEMLHARSAEKSSRFGVCEGFDV
NKCKHSVKKSCTWKPPVRQLKIFNGSSPALSWKISASSSGAQPLEETNQYTRIMPLVPIL
YEESLASYPRVRKARCLER
Download sequence
Identical sequences K3ZF66
XP_004961320.1.39314 Si025215m|PACid:19700341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]