SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si025216m|PACid:19701454 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si025216m|PACid:19701454
Domain Number 1 Region: 3-45
Classification Level Classification E-value
Superfamily F-box domain 0.00000000876
Family F-box domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si025216m|PACid:19701454
Sequence length 326
Sequence
MSDPSGSPDWSSLPRDLLIAVLSRLDAPSALAYAGVCAAWRAAVAAAAGVPLARTPCLFS
WEPDDTHMCGGPTSATLRCLLGAGNASFPTAPFPGGRSLRCCGASHGWIVASDERSNLVL
YNPFARPSAAANFIPLPPVTDFECVLPGYGSDDGGVVAYVHDEYSGFDAESFGSCFYQKA
ILSSAPSSTGTGGAAYTAAIIHCHRRSLSFAKAGDSEWRQASTMGEENVYEVTRDIFEGG
QHFTAKFHQYDEYSDIIHHDGRVYTVTVHGVVECWDLSGPNVEVIGTLGCVADDVKLLSR
HLVSTPWGDLLQVRATMARNLDKYPQ
Download sequence
Identical sequences K3ZF67
Si025216m|PACid:19701454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]