SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si025260m|PACid:19702069 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si025260m|PACid:19702069
Domain Number 1 Region: 44-104
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000314
Family F-box domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si025260m|PACid:19702069
Sequence length 172
Sequence
MAQSRPEAGKNAPHEGTCLLLGYRPDLFGEYLRHDAVGKLDQDGRAQAAVGPWHGDLIRK
LPDDILGRILSLVGYKYAVRASATCRRWKDMHLQAPHVWLYTVSRGAGATQSMERMLRRR
RRVQRLRVVYRADVPAQRECMARLIELADAPALEVCAQCTDKRLPEGGAGGA
Download sequence
Identical sequences K3ZFB1
Si025260m|PACid:19702069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]