SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si025322m|PACid:19698700 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si025322m|PACid:19698700
Domain Number - Region: 5-44
Classification Level Classification E-value
Superfamily F-box domain 0.00068
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si025322m|PACid:19698700
Sequence length 375
Sequence
MAEHRRWTDDLPADLMSEIVRLFPCAKDRRTITTVCRTWRARAQIPPPPPALPWLLLPSA
GSTPVHCFLSDFRVRHDIGAPPHGARYFGSHDGAWLFLAYQTRRHELLNLRDNSSYVLPD
LVRQHRTTATWSSSPPPSSPPGHPNCVGACIIGSWPDNPALRRLAFWRMRSLSAKPDWLP
PVDFEVEDVVYHGVAFHFLTRGEHIRVCEPVLGEGGRMLLLPELKFLQPEGRNYDGLVVR
ARYLVASGGELLMVVRVFRARLRFPSPTMTTRRTIKARRLSTPGAGASWTRWVLFVGRGC
SRSYEVAQYPGFKAGIYFLDDRSFYDEGMMFRGVNEKQYPCNDNGKWSEGPPPGIKGYAP
QDSSNNCSPPAWLLP
Download sequence
Identical sequences K3ZFH1
Si025322m|PACid:19698700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]