SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si025329m|PACid:19700905 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si025329m|PACid:19700905
Domain Number 1 Region: 11-53
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000379
Family F-box domain 0.012
Further Details:      
 
Domain Number 2 Region: 106-342
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000942
Family Methylamine dehydrogenase, H-chain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si025329m|PACid:19700905
Sequence length 368
Sequence
MVKGRRSKRRRCPAASLTDDLIVEILSRLPARSVCRFRCVSTAWRDLIYANHRKLPQTLA
GFFTMHDGEGSMSSVPHFTNVSGRDGPLVPSSFEFLPNRVYLQHSCNGLVLCSYWPNQPD
ELYCFVCNPATKKWMQLPGFLFGGRCWGLSLGFDPIASPHFYVFQLFEDYRNLVAGVQVY
SSETGQTVGEETEWDNRVIGRCAPFSVSVFLNGCQHYLTYDPAIAVVDTRGKLRRSIPVP
DNKDDGFIHQSQGRLHYANFEADDEDEVVRLVVYVLEDYDNQQWTLKHSAEAEYVLGRTS
SNLFRDFELVAIHPDCNIIFYTVGWDKTLMSYDMDRRRVQVICTLGQDTRERYLPYVPWF
SELQALHA
Download sequence
Identical sequences K3ZFH7
XP_004962998.1.39314 XP_004962999.1.39314 XP_004963000.1.39314 Si025329m|PACid:19700905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]