SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si025347m|PACid:19698733 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si025347m|PACid:19698733
Domain Number - Region: 146-188
Classification Level Classification E-value
Superfamily F-box domain 0.0196
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si025347m|PACid:19698733
Sequence length 639
Sequence
PPVASLLPRFASGLPSCSPAAQLRRPRRSIPFGRHPSPVFVSASPRLQAPVRSSLAVVLS
RYPASSSQPCRSPTGPRASPRRTPVQAPAAAALAWTPGSACAGSSRSQVRGWRPAGPSQP
RKGRRAVGGSGTPIPSTDDPTAPMAEPPPWADGLPHAALREIVRRVPCAVDRGSMAGACR
SWRARLADLPPPPPPLPWLVLPSGGSTRFYCALSGCVHHYETNAPPHGARFFGSHEGAWL
FLAFNQNTDHELVNLRADRTFLIPDKYRLQQDGPLAAAHDDMVILAAALSSPPDQGKCVG
ACIISRWPANVPTLRRFAFWHVEFGGDADAYDLMPDPDPTPPHLQVEDVLCYQGAFYFLT
QGEHIRRCEPVHDAGGDLEVLSDVWFFQREGRNYDGLVVQARYLVVSRDELLMVVRLTCG
ANKPAAAFRVFRALRPVQDVEEVADEDGEDNQVAEADDQGEEIEYPWSWGELDTLGGQML
FVGRGCSRSYKTAEYPGFEDGIYFLDDRSFYDDHCVCERQYPCSNNGRWTQGPPPNIELY
FPEQGPSDHSPPAWLLLYNRPYAKALPLDMVREISRHIICDTERVRTLRVCCLVLSDPGA
RAIQPQLPWLLAASTDGPLLYCLNCGSGGNGTTHTTGAP
Download sequence
Identical sequences K3ZFJ5
Si025347m|PACid:19698733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]