SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si026233m|PACid:19706373 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si026233m|PACid:19706373
Domain Number 1 Region: 165-281,326-391
Classification Level Classification E-value
Superfamily RNI-like 0.00000000863
Family 28-residue LRR 0.054
Further Details:      
 
Domain Number 2 Region: 53-90
Classification Level Classification E-value
Superfamily F-box domain 0.000017
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si026233m|PACid:19706373
Sequence length 515
Sequence
MGILEQMKALSAEGQPQVQITRDGSNCSASQIMVSPSLEGDISHCVETMGSQVQLPEDIL
HQIHALMPLRDAAQAACVSRGFLRSWRCFPNLIISVGSLGINENTSNDDEIKRDFICRVD
HIMQNHSSMGVKRFVMETYPCSNLQPSYVDRWLQCAITPGIKEIYLSVFSCGIKYNFPGL
LLFSREIRSSIQTFVLGDCSFHCAAQVGYMSSLTNLELHSVHITGEELYGFLSNSCAVEQ
LRLTNCNDIICLKIPCLLQKLDILHLVGCSKLEMIDSNAPNLSTFFFAGRPIHILLGEAL
QVRKISFFRDFSPDALYYASTKFPFIAPNLQTLVLSTSDETVNTPKVFGKFIQLKYLEIV
VSTLKFSQDYDLCSLISFLDASPALESLIVRIAQPTIRRDSVIEDSNGYSRPQCLQEQCH
DNLKNVMITGFCSAKSMIELTICIIEKTKALACLTLDTTRGYDRRLVKFDKCLQLGKEAL
VEAKRARVAIQRYIEGRVPPAVNLKVIEPCSKCIW
Download sequence
Identical sequences K3ZI31
Si026233m|PACid:19706373 XP_004979374.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]