SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si026234m|PACid:19707266 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si026234m|PACid:19707266
Domain Number 1 Region: 179-361
Classification Level Classification E-value
Superfamily RNI-like 0.000000000341
Family 28-residue LRR 0.062
Further Details:      
 
Domain Number 2 Region: 53-91
Classification Level Classification E-value
Superfamily F-box domain 0.0000157
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si026234m|PACid:19707266
Sequence length 514
Sequence
MGILEQMKALSVEGQPQVQITRDGSNCSASQIMVSPSLEGDISHCVETMGSQVQLPEDIL
HQIHALMPLRDAAQAACVSRGFLRSWRCFPNLIISVDSLGINENTSNDEIKRDFVCRVDH
IMQNHSSMGVKRFVMGTYPCSKLQPSYVDRWLQCAITPGIKEIYLSMLSCGIKYNFPGLL
LFSREIRSSIQTFVLGGCSFRCAAQVGYMSSLTNLELHSVHITGEELYGFLSNSCAVEEL
RLSNCNDIICLKIPCLLQKLDILDVVGCSKLEMIDSNAPNLSTFFFAGRPIHILLGEALQ
VRKISFFRDYSPDALYYASTKFPFIAPNLQTLVLSTSDETVNTPKVFGKFIQLKYLEIWV
STSTFSQDYDLCSLISFLDASPALESLIVRIAQPTIRRDSVIEDSNGYSRPQCLQEQCHD
NLKNVMITGFCSAKSMIELTICIIEKSKALACLTLDTTRGYDRRLVKFDKCLQLGKEALV
EAKRARVAIQRYIEGRVPPAVNLKVIEPCSKCIW
Download sequence
Identical sequences K3ZI32
Si026234m|PACid:19707266 XP_004979380.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]