SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si026250m|PACid:19708141 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si026250m|PACid:19708141
Domain Number 1 Region: 184-437
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 7.83e-60
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.011
Further Details:      
 
Domain Number 2 Region: 85-148
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000549
Family F-box domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si026250m|PACid:19708141
Sequence length 506
Sequence
MPGAFHSLLLPLQRKRKSKRHRSRNHPKENKPKNHLAAAGDPSFHLKSSASASSRDIGCL
VQPLGNLFLAATPRANLRDAGLGALRPLPDDLLLDVLGLLPARDLAALSAASKALYVVAA
HDPLWRAFVLDELGGAFDFAGSWRTTYIAAASGGQPHLIPPRALKIRGFYSDYLFQSWLC
ANMEMRHEWLARDNIERRRGISVEQFIAEVEEPNRPVLLEGCIDGWPALQKWSREYLLEI
SAGKEFAVGPVSMTLDRYFRYADNVQEERPLYLFDAKFAEKVPEMGRDYEVPVYFREDLF
SVLGEERPDYRWVIIGPAGSGSSFHVDPNSTSAWNAIIKGSKKWVMFPPEVVPPGVHPSA
DGAEVTSPVSIMEWFMNFYGACKTWEKRPIECVCRAGEVVFVPNGWWHLVINLEESIAIT
QNYVSRRNLLNVLDFLKKPNASELVSGTKDRVNLHDKFCGAIEATHPGMINQLQLEAQQK
AAARKKQASFWDSAADAKSGGFKFSF
Download sequence
Identical sequences K3ZI48
Si026250m|PACid:19708141 XP_004979531.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]