SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si026290m|PACid:19708112 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si026290m|PACid:19708112
Domain Number 1 Region: 54-99
Classification Level Classification E-value
Superfamily F-box domain 0.0000676
Family F-box domain 0.01
Further Details:      
 
Weak hits

Sequence:  Si026290m|PACid:19708112
Domain Number - Region: 196-340
Classification Level Classification E-value
Superfamily L domain-like 0.0612
Family Internalin LRR domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si026290m|PACid:19708112
Sequence length 484
Sequence
MGVLEEMDAMSAKGQPQCPVTGDGSTCLAAQIKASPCQQGDDSDYAEIRGSQVQLPEDIL
RHIHTFMQMQDVAQAACVYRSFLRSWSCYPKLMLSVDSLRIKEDASRKDEISREFISRVD
HILQNHSGMGVKMFSLHTYPCSDLHPSYVDRWLQIAITPGIENFELTMFGRRDIKYNFPC
SVLSSERRSSIQSFLLGQFYLSNCRDIICLKIPYLLKQLNILHVFCCLKLEMIESNAPKL
SIFYYAGDPICTSVGDALHVRRVDFRHDHSPGALYYARTKLPLIVPNVRTLVLSTRAEVS
LILPKHFITGNTPMASCKFLQLKYLEIVLCALIFPSDYDFYSLVSFLDASPALETFVLRI
AMPTIRPDSIIEDSGGDFSRPRCLSEQCHGRLKNVMITGFCSAKSMIELTIHIIGKTMSL
VSLTLDTTRGHDRRCSRSDKCLQLSKDALVEAEKARVAIQRYVEGRVPSSVNQKVIEPCS
KCIY
Download sequence
Identical sequences K3ZI88
Si026290m|PACid:19708112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]