SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si026356m|PACid:19707547 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si026356m|PACid:19707547
Domain Number 1 Region: 314-452
Classification Level Classification E-value
Superfamily ApaG-like 1.31e-28
Family ApaG-like 0.00032
Further Details:      
 
Domain Number 2 Region: 28-74
Classification Level Classification E-value
Superfamily F-box domain 0.00000676
Family F-box domain 0.011
Further Details:      
 
Domain Number 3 Region: 106-242
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000107
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si026356m|PACid:19707547
Sequence length 452
Sequence
MASPPPPEPTPAAAAGLESMEGLALDTVISKAGPRPAAALACASKRLRAAVADDSLWRRF
CADDLGLDAPVDPEGRPLPSFQVAYKVWLESFGMYPLSLVKRVKEFWGSMKKWLSENFPE
AAKTLCKGVSEAQLKSAEDDLGFKLPMPTKLLYRFCNAQLPFSDNDEANVRSSTHGIIGG
YAFYDYWVNVHLSPLEQIVEETKQFYREFPDVFNGRKFIIVATSWFHPKTFILNCSNGEL
YVGTNNLPVGEMLPCVPKALVKPTDTDLPQDGLLLWLEEHLRRLQNGMIKTRMLLKSRYI
SLYPEAPPLCTSAMTNGVKVRASAVFVPEHPQTQGHERSLLYTYSIRMSVPEACMLGGVY
YSSCQLHSRHWTIRSRDRVVSVVSGEGVIGQYPVLSPGRDEFVYESCTPLPKGPGSVEGS
FSFVPGKLSRPEGKPFEVTVAPFPLEVPEYIF
Download sequence
Identical sequences K3ZIF4
XP_004979136.1.39314 Si026356m|PACid:19707547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]