SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si026380m|PACid:19707610 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si026380m|PACid:19707610
Domain Number 1 Region: 131-372
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.39e-33
Family WD40-repeat 0.0032
Further Details:      
 
Domain Number 2 Region: 29-86
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000183
Family F-box domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si026380m|PACid:19707610
Sequence length 439
Sequence
MEAGSSRGRSGSAALKRRRGSGAGSGSGSTAQSLNDDILRSVFSRLDDHFDLARCSAVCS
SWNRIIVTAHLMRDLYYKRNPPARGSNSNISVKSYFEALAMDEHASSLSNGPADAYQWVG
HPMRATLCRMKGGSILTGVGDKILRLWSAETCKFMNEYNVPNAKTLVDFEFDENKIVGLT
SSQICIWRRSEPRSIFQSSGASFNHGLCMSYADPEVVIGCEDGRAFVYDMYSRSCSSIYR
LHSSPVTCLTITDDQLILGGSTFGNIAIADQTSGQKIGVLKSAYAPLAIRSLSFSTNSHM
IFAGSSAGYAHCWDLRTLRPLWEQRVSPNVIYSAHHLPGDTTALAVGGIDGVLRLISQRT
GEIIRSIVVDTDRPAEPTSRSRHQIEKKRVREVAPDARVDNISTRLRPQITSLSVGIKKI
VTTHGENYIRVLKFCPKNS
Download sequence
Identical sequences K3ZIH8
Si026380m|PACid:19707610 XP_004978874.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]