SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si026390m|PACid:19707958 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si026390m|PACid:19707958
Domain Number 1 Region: 155-431
Classification Level Classification E-value
Superfamily Kelch motif 5.89e-48
Family Kelch motif 0.0012
Further Details:      
 
Weak hits

Sequence:  Si026390m|PACid:19707958
Domain Number - Region: 96-143
Classification Level Classification E-value
Superfamily F-box domain 0.00632
Family F-box domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si026390m|PACid:19707958
Sequence length 434
Sequence
MLGDQRMILALDSATSSSSAPGLTLSEDLTSGSSNCVTESLQVPCAQKGGQVEGLVNCYR
KKNKVGSGSGNPAIEGWGSNMEDGDQNGEVNTSELISGIGRELAISCLLRLPRSYYYDVA
CVNRSFYSLVRSGELYRLRREARIVEQMIYCSCNVLEWDGFDPCRQRWFSIPSMPPIECF
TLADKESLAVGTNILVFGRRVEAHVVLRYSLLTNSWTTGEMMNTPRCLFGSASFGEKAIV
AGGIGENGTLSSAELYDSEMRTWTTLPSMNRARQMCSGFFMDGKFYVIGGKSEKHNEILS
CAEEFDLENGTWRLIPDMARGLNGGCGAPPLVAVVNNELYAADYASREVRKYDKENNSWI
TLGSLPGRYTSVHGWGLAFRSCGDMLIVIGGMSLGGSGVIEICSWVPNNGLPDWKIIGTR
HSGSFVYNCAVMNC
Download sequence
Identical sequences K3ZII8
Si026390m|PACid:19707958 XP_012704068.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]