SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si026413m|PACid:19708764 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si026413m|PACid:19708764
Domain Number 1 Region: 3-56
Classification Level Classification E-value
Superfamily F-box domain 0.000000000131
Family F-box domain 0.0081
Further Details:      
 
Domain Number 2 Region: 122-234,307-359
Classification Level Classification E-value
Superfamily RNI-like 0.00000000294
Family 28-residue LRR 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si026413m|PACid:19708764
Sequence length 423
Sequence
MASGADRISDLPEGVLHHILSLLPAQDAVRTCVLAQSWRHHWRSAPAVRFAGCTGWAGGA
YTFGPFVDGLLSARRGGAPLDSCDFDLDVNLDLGRYDLDLGRYDVPKMERRVNSWIRRAL
RRQVRELRFQVSITPRLPFSLEDRPLASEHLTRLELATVRGNSSVLDFSSCPALEDLTME
DCDVGSLEIHSPSLRHLRIRYCLFYCNYRTRMSFPNLVTFQFITNAGRVPLLESMPSLET
ATVRYDHFYDDRCENGRLDDCGDTGCDGCFFYYGPHDYNCVFLEGLTEATDLKLSAYPDL
YVFNRDLEWCPAFSKLKTLVLSKWFVSADLSAVIWFLCHAPLLEKLTLKPSKVRDNLMKN
DGSYKPLEQSIAVSHLQIVEIKCKDVDEIVLEILKVLNATGIPQEKIRIRYSAGYNFVHT
DST
Download sequence
Identical sequences K3ZIL1
XP_004978784.1.39314 XP_004978785.1.39314 XP_004978786.1.39314 Si026413m|PACid:19708764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]