SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si026470m|PACid:19707681 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si026470m|PACid:19707681
Domain Number 1 Region: 5-73
Classification Level Classification E-value
Superfamily F-box domain 0.000000000089
Family F-box domain 0.0057
Further Details:      
 
Weak hits

Sequence:  Si026470m|PACid:19707681
Domain Number - Region: 107-223
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000183
Family Galactose oxidase, central domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si026470m|PACid:19707681
Sequence length 392
Sequence
MPWQTRFSDLHDDLAAAVLARLPLRHVARARLVCRWWRALTTDHRFLRDTASRRAVGFFL
NDQSCIRADYRAFPFPNKIDDGSAAAEEDRPAPDLSFVPNAAVSTDPPSGGAGSVHVCSS
CNGLLLLVCRTPHLPAAHYVCNPLTRQLAPIPQPNGIPNLAFDPAVLLHYKVVVLGDTYA
IDVYSSETRSWRTALHPERSLFSGLRSMRGVFWNGSMVWTVGHSLIQFVLQGEHLRTIPM
PPKRKEGWICAYIGESDGHLQMIGYTKKEKLTACFEILEMNSDQSEWSLLYRVDLSRVKE
LHPEIEWPTWDTRRDEHKVIDYLALSPVCVIRGTREAGKDGVLIFSIPGKIMLYDMKDQG
ISVTREARSPYNLELEHPWYYFFAYSPSLFTL
Download sequence
Identical sequences K3ZIR8
XP_004979015.1.39314 Si026470m|PACid:19707681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]