SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si026494m|PACid:19706374 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si026494m|PACid:19706374
Domain Number 1 Region: 165-337
Classification Level Classification E-value
Superfamily RNI-like 0.0000000534
Family 28-residue LRR 0.063
Further Details:      
 
Domain Number 2 Region: 53-89
Classification Level Classification E-value
Superfamily F-box domain 0.0000144
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si026494m|PACid:19706374
Sequence length 382
Sequence
MGILEQMKALSAEGQPQVQITRDGSNCSASQIMVSPSLEGDISHCVETMGSQVQLPEDIL
HQIHALMPLRDAAQAACVSRGFLRSWRCFPNLIISVGSLGINENTSNDDEIKRDFICRVD
HIMQNHSSMGVKRFVMETYPCSNLQPSYVDRWLQCAITPGIKEIYLSVFSCGIKYNFPGL
LLFSREIRSSIQTFVLGDCSFHCAAQVGYMSSLTNLELHSVHITGEELYGFLSNSCAVEQ
LRLTNCNDIICLKIPCLLQKLDILHLVGCSKLEMIDSNAPNLSTFFFAGRPIHILLGEAL
QVRKISFFRDFSPDALYYASTKFPFIAPNLQTLVLSTSDESTINLRGTFISSDSQYTKGV
WQIHPAQVLGDSGLYIKVFPRL
Download sequence
Identical sequences K3ZIU1
Si026494m|PACid:19706374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]