SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si026513m|PACid:19707242 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si026513m|PACid:19707242
Domain Number 1 Region: 99-362
Classification Level Classification E-value
Superfamily Kelch motif 4.45e-46
Family Kelch motif 0.0026
Further Details:      
 
Domain Number 2 Region: 13-61
Classification Level Classification E-value
Superfamily F-box domain 0.00000000235
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si026513m|PACid:19707242
Sequence length 375
Sequence
MKNPRGVGGGRGGPMEHVDLIPGIPDDVAVDCLARVPHASYRALRRVCRGWRSAAAAPSF
ASARAAAGANEDLVYMLQFGNPSADDGPKDGDAPASTPAYGVAVYNVTTGEWRREPGAPP
VVPVFAQCAAVGTRVAVLGGWDPRTFEPVADVHVLDAATGEWRHGAPMRSARSFFACAEA
GGKIYVAGGHDKHKNALKTAEAYDAEADAWDPLPDMSEERDECDGMATVAGDRFLAVSGY
RTARQGGFERDAEWFDPAARAWRRLERVRAPPSAAHVVVRGRVWCIEGNAMMEWMGTRRG
WTEVGPYPPGLKAGTARAVCVGGGEKVVVTGALDGEGGGARHAVWVFDVKTKNWTVVRPP
PEFAGFVFSVTSVRI
Download sequence
Identical sequences K3ZIW0
XP_004978976.1.39314 Si026513m|PACid:19707242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]