SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si026551m|PACid:19707825 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si026551m|PACid:19707825
Domain Number 1 Region: 5-44
Classification Level Classification E-value
Superfamily F-box domain 0.000000563
Family F-box domain 0.0078
Further Details:      
 
Weak hits

Sequence:  Si026551m|PACid:19707825
Domain Number - Region: 196-260
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0339
Family Reprolysin-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si026551m|PACid:19707825
Sequence length 361
Sequence
MKGAPSPWSEIPPELAGLVLHRLHAHIDRVRFAAVCKQWRSAAQQVPLPPPLPVLALKEG
TFYSMPRGEPLHFPGCDGGFIMASGNWLVYNRLHCLLLVDPFSGATMTLPALRSIYPLEE
SMDMVVVKLIECSPHLIAALFKGGRNFWIAVCRPGDSSWSAAQKLPMGILDIAFYQEKLY
ALSFLQDLFALDISVDDNTGNPQVALIGRVIKGGYIYLDHNFMRVLYLIESRGSLLMVRR
SIFHEHGHGKGQIHTFAEQCEPELAVFEPDFGQSRWTNAMTVGDDQVLFLGMFSRAVCMP
LCDSQDKRMWLLDDYRRDHCDGETCSGTGDMRIGKYSCPLPKISWRAHNLCAGAVWLFPS
N
Download sequence
Identical sequences K3ZIZ8
XP_004979654.1.39314 Si026551m|PACid:19707825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]