SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si026558m|PACid:19706376 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si026558m|PACid:19706376
Domain Number 1 Region: 183-339
Classification Level Classification E-value
Superfamily RNI-like 0.0000000255
Family 28-residue LRR 0.063
Further Details:      
 
Domain Number 2 Region: 53-90
Classification Level Classification E-value
Superfamily F-box domain 0.0000129
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si026558m|PACid:19706376
Sequence length 359
Sequence
MGILEQMKALSAEGQPQVQITRDGSNCSASQIMVSPSLEGDISHCVETMGSQVQLPEDIL
HQIHALMPLRDAAQAACVSRGFLRSWRCFPNLIISVGSLGINENTSNDDEIKRDFICRVD
HIMQNHSSMGVKRFVMETYPCSNLQPSYVDRWLQCAITPGIKEIYLSVFSCGIKYNFPGL
LLFSREIRSSIQTFVLGDCSFHCAAQVGYMSSLTNLELHSVHITGEELYGFLSNSCAVEQ
LRLTNCNDIICLKIPCLLQKLDILHLVGCSKLEMIDSNAPNLSTFFFAGRPIHILLGEAL
QVRKISFFRDFSPDALYYASTKFPFIAPNLQTLVLSTSDEVSFIHPNKFIVLEMKLMVE
Download sequence
Identical sequences K3ZJ05
Si026556m|PACid:19706375 Si026558m|PACid:19706376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]