SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si026600m|PACid:19706227 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si026600m|PACid:19706227
Domain Number 1 Region: 102-221
Classification Level Classification E-value
Superfamily HCP-like 0.0000000000288
Family HCP-like 0.014
Further Details:      
 
Domain Number 2 Region: 289-329
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00000000576
Family MYND zinc finger 0.013
Further Details:      
 
Domain Number 3 Region: 34-85
Classification Level Classification E-value
Superfamily F-box domain 0.000000406
Family F-box domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si026600m|PACid:19706227
Sequence length 339
Sequence
MRKPTRRSSLVKKGSGGRTTAVLLAKQELVLGHGGGVDAFDRLPDDLVLAVLAGVAACAA
GPADLAAAALTCRRFRELAAHPAVLSRASAAAVSLRAGRWSEAAHQFLRRCAAAGSLHAC
YFLGMVRFYCLGSRATGAALLARAASGGHAAALYALAVLQFNGSGGGKADKDPRAGVALC
ARAAWLGHVPALRELGHCLQDGYGARRDAAAGRHLLLHAAARELVAISSARCRRGGRRAE
DGDDAASRFMVEWWALSAAKKSAAATGEGDGGNDAAELRLCSQAPCGRRETRRHEFRRCS
ACGSASYCSRACQALDWKRAHRGQCGAAAARWLAAGDAY
Download sequence
Identical sequences K3ZJ47
XP_004979281.1.39314 Si026600m|PACid:19706227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]