SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si026697m|PACid:19706778 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si026697m|PACid:19706778
Domain Number 1 Region: 20-75
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000497
Family F-box domain 0.0039
Further Details:      
 
Domain Number 2 Region: 156-278
Classification Level Classification E-value
Superfamily RNI-like 0.00000000141
Family Rna1p (RanGAP1), N-terminal domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si026697m|PACid:19706778
Sequence length 297
Sequence
MKQALRGTAIPGSSSQKSAPDRISALPDELLLHVMYFLTLQEAAQTSLLSRRWQNLWASL
MWLNFDAAKFSSMRTYRKFVNNALLIRSSLPVPVPLDAFWISAECDNSDDSLDYSDMHPW
IRHALNSKAWAIGILKHFGPKPLSMQGYPFPFTSVYLKILGLCHCSIDDWFAQNLSSCCP
LLDDLDLMSCAIHATMFSSTTLKSLAITSTQTEKDFPIEFQYLVINMPNLVSLSLEEIPR
RNIHLMDVSSVKTVSIYLYSLSFSNSQVQCSILSALSNANSLTLVSPSVYEDVCYLL
Download sequence
Identical sequences K3ZJE4
Si026697m|PACid:19706778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]